PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007634P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 238aa    MW: 26725.3 Da    PI: 10.2029
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007634P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.41.4e-072164344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     +WT   d+l+ +a  + + +   +W +Ia+ ++ g+++ +++ ++
   MELO3C007634P1 21 PWTRHQDDLFERALVLVPDNspdRWIKIAALVP-GKSAADVRYHY 64
                     8*****************99*************.**********9 PP

2Myb_DNA-binding40.28.1e-13117162247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+ E++l++ + +++G+g+W++I+r    +Rt+ q+ s+ qky
   MELO3C007634P1 117 KPWTKKEHQLFLLGLRKFGKGDWRSISRNAVITRTPTQVASHAQKY 162
                      58*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.7E-61870IPR001005SANT/Myb domain
SuperFamilySSF466893.09E-112076IPR009057Homeodomain-like
CDDcd001676.61E-62164No hitNo description
PROSITE profilePS500905.9352168IPR017877Myb-like domain
PfamPF002491.5E-52164IPR001005SANT/Myb domain
PROSITE profilePS5129418.331111167IPR017930Myb domain
SuperFamilySSF466898.61E-16113168IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-16114166IPR006447Myb domain, plants
SMARTSM007171.6E-10115165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-11115161IPR009057Homeodomain-like
PfamPF002491.8E-11117162IPR001005SANT/Myb domain
CDDcd001671.15E-9118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MEAHSSSVGL LPITSFSSPT PWTRHQDDLF ERALVLVPDN SPDRWIKIAA LVPGKSAADV  60
RYHYDVLVSD VLNIDSGRVE LPNYADDLTA ARSPEREKSP PHPISEKASS SERKKGKPWT  120
KKEHQLFLLG LRKFGKGDWR SISRNAVITR TPTQVASHAQ KYFLRQESAK KDRKRSSIHD  180
ITTVEGNLVM TSTTVINQSQ PNIFPVTQPL SSSFPLHMPH QFASSGYFPY RRGMLDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-141784673RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440393.11e-171PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-54DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KJP91e-151A0A0A0KJP9_CUCSA; Uncharacterized protein
STRINGGLYMA20G24600.19e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.15e-59MYB family protein